ATP synthase subunit c
Details
- Name
- ATP synthase subunit c
- Synonyms
- ATP synthase F(0) sector subunit c
- F-ATPase subunit c
- F-type ATPase subunit c
- Lipid-binding protein
- Gene Name
- atpE
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Amino acid sequence
>lcl|BSEQ0051282|ATP synthase subunit c MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK
- Number of residues
- 81
- Molecular Weight
- 8055.41
- Theoretical pI
- Not Available
- GO Classification
- Functionslipid binding / proton-transporting ATP synthase activity, rotational mechanismProcessesATP hydrolysis coupled proton transport / ATP synthesis coupled proton transport / growthComponentsintegral component of membrane / plasma membrane / proton-transporting ATP synthase complex, coupling factor F(o)
- General Function
- F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
- Specific Function
- Lipid binding
- Pfam Domain Function
- ATP-synt_C (PF00137)
- Transmembrane Regions
- 5-25 57-77
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0051283|ATP synthase subunit c (atpE) ATGGACCCCACTATCGCTGCCGGCGCCCTCATCGGCGGTGGACTGATCATGGCCGGTGGC GCCATCGGCGCCGGTATCGGTGACGGTGTCGCCGGTAACGCGCTTATCTCCGGTGTCGCC CGGCAACCCGAGGCGCAAGGGCGGCTGTTCACACCGTTCTTCATCACCGTCGGTTTGGTT GAGGCGGCATACTTCATCAACCTGGCGTTTATGGCGCTGTTCGTCTTCGCTACACCCGTC AAGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WPS1 UniProtKB Entry Name ATPL_MYCTU - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Raman K, Yeturu K, Chandra N: targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis. BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109. [Article]