Sermorelin
Identification
- Generic Name
- Sermorelin
- DrugBank Accession Number
- DB00010
- Background
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues
- Type
- Biotech
- Groups
- Approved, Withdrawn
- Biologic Classification
- Protein Based Therapies
Hormones - Protein Chemical Formula
- C149H246N44O42S
- Protein Average Weight
- 3357.882 Da
- Sequences
>DB00010 sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Download FASTA Format- Synonyms
- Sermorelin
Pharmacology
- Indication
For the treatment of dwarfism, prevention of HIV-induced weight loss
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
Sermorelin is used in the treatment of children with growth hormone deficiency or growth failure. Geref increases plasma growth hormone (GH) concentration by stimulating the pituitary gland to release GH. Geref is similar to the full-length native hormone (44 residues) in its ability to stimulate GH secretion in humans.
- Mechanism of action
Sermorelin binds to the growth hormone releasing hormone receptor and mimics native GRF in its ability to stimulate growth hormone secretion.
Target Actions Organism AGrowth hormone-releasing hormone receptor agonistHumans - Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
11-12 min
- Clearance
Not Available
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.No interactions found.
- Food Interactions
- Not Available
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- Product Ingredients
Ingredient UNII CAS InChI Key Sermorelin acetate 00IBG87IQW 114466-38-5 Not applicable - International/Other Brands
- Geref (Serono Pharma)
Categories
- ATC Codes
- V04CD03 — Sermorelin
- V04CD — Tests for pituitary function
- V04C — OTHER DIAGNOSTIC AGENTS
- V04 — DIAGNOSTIC AGENTS
- V — VARIOUS
- Drug Categories
- Amino Acids, Peptides, and Proteins
- Anterior Pituitary Lobe Hormones and Analogues
- Diagnostic Agents
- Growth Hormone-Releasing Hormone
- Hormones
- Hormones, Hormone Substitutes, and Hormone Antagonists
- Hypothalamic Hormones
- Nerve Tissue Proteins
- Neuropeptides
- Peptide Hormones
- Peptides
- Pituitary and Hypothalamic Hormones and Analogues
- Pituitary Hormone-Releasing Hormones
- Somatropin and Somatropin Agonists
- Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins
- Tests for Pituitary Function
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- 89243S03TE
- CAS number
- 86168-78-7
References
- General References
- Not Available
- External Links
- KEGG Compound
- C08192
- PubChem Substance
- 46507399
- 56188
- Therapeutic Targets Database
- DAP001055
- PharmGKB
- PA164749110
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Sermorelin
Clinical Trials
Pharmacoeconomics
- Manufacturers
- Emd serono inc
- Packagers
- Chengdu Shengnuo Bio Pharmaceutical Co. Ltd.
- Letco Medical Inc.
- Live Well Drugstore LLC
- Dosage Forms
Form Route Strength Injection, powder, for solution Intravenous - Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
Property Value Source hydrophobicity -0.330 Not Available isoelectric point 9.99 Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Agonist
- General Function
- Peptide hormone binding
- Specific Function
- Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
- Gene Name
- GHRHR
- Uniprot ID
- Q02643
- Uniprot Name
- Growth hormone-releasing hormone receptor
- Molecular Weight
- 47401.53 Da
References
- Esposito P, Barbero L, Caccia P, Caliceti P, D'Antonio M, Piquet G, Veronese FM: PEGylation of growth hormone-releasing hormone (GRF) analogues. Adv Drug Deliv Rev. 2003 Sep 26;55(10):1279-91. [Article]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
Drug created at June 13, 2005 13:24 / Updated at April 09, 2024 18:10