Alpha-1-acid glycoprotein 1
Details
- Name
- Alpha-1-acid glycoprotein 1
- Synonyms
- AGP 1
- AGP1
- OMD 1
- Orosomucoid-1
- Gene Name
- ORM1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0001842|Alpha-1-acid glycoprotein 1 MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK DKCEPLEKQHEKERKQEEGES
- Number of residues
- 201
- Molecular Weight
- 23511.38
- Theoretical pI
- 4.66
- GO Classification
- Processesacute-phase response / inflammatory response / negative regulation of interleukin-6 production / negative regulation of tumor necrosis factor production / regulation of immune system process / transportComponentsblood microparticle / extracellular exosome / extracellular region / extracellular space
- General Function
- Not Available
- Specific Function
- Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
- Pfam Domain Function
- Lipocalin (PF00061)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0010649|Alpha-1-acid glycoprotein 1 (ORM1) ATGGCGCTGTCCTGGGTTCTTACAGTCCTGAGCCTCCTACCTCTGCTGGAAGCCCAGATC CCATTGTGTGCCAACCTAGTACCGGTGCCCATCACCAACGCCACCCTGGACCGGATCACT GGCAAGTGGTTTTATATCGCATCGGCCTTTCGAAACGAGGAGTACAATAAGTCGGTTCAG GAGATCCAAGCAACCTTCTTTTACTTCACCCCCAACAAGACAGAGGACACGATCTTTCTC AGAGAGTACCAGACCCGACAGGACCAGTGCATCTATAACACCACCTACCTGAATGTCCAG CGGGAAAATGGGACCATCTCCAGATACGTGGGAGGCCAAGAGCATTTCGCTCACTTGCTG ATCCTCAGGGACACCAAGACCTACATGCTTGCTTTTGACGTGAACGATGAGAAGAACTGG GGGCTGTCTGTCTATGCTGACAAGCCAGAGACGACCAAGGAGCAACTGGGAGAGTTCTAC GAAGCTCTCGACTGCTTGCGCATTCCCAAGTCAGATGTCGTGTACACCGATTGGAAAAAG GATAAGTGTGAGCCACTGGAGAAGCAGCACGAGAAGGAGAGGAAACAGGAGGAGGGGGAA TCCTAG
- Chromosome Location
- 9
- Locus
- 9q31-q32
- External Identifiers
Resource Link UniProtKB ID P02763 UniProtKB Entry Name A1AG1_HUMAN GenBank Protein ID 757907 GenBank Gene ID X02544 GenAtlas ID ORM1 HGNC ID HGNC:8498 - General References
- Dente L, Pizza MG, Metspalu A, Cortese R: Structure and expression of the genes coding for human alpha 1-acid glycoprotein. EMBO J. 1987 Aug;6(8):2289-96. [Article]
- Board PG, Jones IM, Bentley AK: Molecular cloning and nucleotide sequence of human alpha 1 acid glycoprotein cDNA. Gene. 1986;44(1):127-31. [Article]
- Dente L, Ciliberto G, Cortese R: Structure of the human alpha 1-acid glycoprotein gene: sequence homology with other human acute phase protein genes. Nucleic Acids Res. 1985 Jun 11;13(11):3941-52. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Schmid K, Kaufmann H, Isemura S, Bauer F, Emura J, Motoyama T, Ishiguro M, Nanno S: Structure of 1 -acid glycoprotein. The complete amino acid sequence, multiple amino acid substitutions, and homology with the immunoglobulins. Biochemistry. 1973 Jul 3;12(14):2711-24. [Article]
- Ikenaka T, Ishiguro M, Emura J, Kaufmann H, Isemura S, Bauer W, Schmid K: Isolation and partial characterization of the cyanogen bromide fragments of 1 -acid glycoprotein and the elucidation of the amino acid sequence of the carboxyl-terminal cyanogen bromide fragment. Biochemistry. 1972 Sep 26;11(20):3817-29. [Article]
- Schmid K, Burgi W, Collins JH, Nanno S: The disulfide bonds of alpha1-acid glycoprotein. Biochemistry. 1974 Jun 18;13(13):2694-7. [Article]
- Treuheit MJ, Costello CE, Halsall HB: Analysis of the five glycosylation sites of human alpha 1-acid glycoprotein. Biochem J. 1992 Apr 1;283 ( Pt 1):105-12. [Article]
- Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [Article]
- Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P: A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation. J Proteome Res. 2004 May-Jun;3(3):556-66. [Article]
- Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [Article]
- Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [Article]
- Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [Article]
- Fitos I, Visy J, Zsila F, Mady G, Simonyi M: Selective binding of imatinib to the genetic variants of human alpha1-acid glycoprotein. Biochim Biophys Acta. 2006 Nov;1760(11):1704-12. Epub 2006 Aug 25. [Article]
- Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503. [Article]
- Zsila F, Iwao Y: The drug binding site of human alpha1-acid glycoprotein: insight from induced circular dichroism and electronic absorption spectra. Biochim Biophys Acta. 2007 May;1770(5):797-809. Epub 2007 Jan 28. [Article]
- Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
- Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [Article]
- Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. [Article]
- Schonfeld DL, Ravelli RB, Mueller U, Skerra A: The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin. J Mol Biol. 2008 Dec 12;384(2):393-405. doi: 10.1016/j.jmb.2008.09.020. Epub 2008 Sep 16. [Article]
- Yuasa I, Umetsu K, Vogt U, Nakamura H, Nanba E, Tamaki N, Irizawa Y: Human orosomucoid polymorphism: molecular basis of the three common ORM1 alleles, ORM1*F1, ORM1*F2, and ORM1*S. Hum Genet. 1997 Mar;99(3):393-8. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00280 Disopyramide approved no other/unknown Details DB00706 Tamsulosin approved, investigational no Details DB00908 Quinidine approved, investigational unknown binder Details DB00946 Phenprocoumon approved, investigational no Details DB01359 Penbutolol approved, investigational unknown other/unknown Details DB01429 Aprindine experimental unknown Details DB01418 Acenocoumarol approved, investigational no Details DB00682 Warfarin approved no Details DB00802 Alfentanil approved, illicit unknown Details DB00540 Nortriptyline approved no binder Details DB00321 Amitriptyline approved no binder Details DB01232 Saquinavir approved, investigational unknown Details DB00334 Olanzapine approved, investigational no binder Details DB00543 Amoxapine approved no Details DB00457 Prazosin approved no substrate Details DB00571 Propranolol approved, investigational no Details DB00458 Imipramine approved no Details DB01151 Desipramine approved, investigational no Details DB04821 Nomifensine approved, withdrawn no Details DB01156 Bupropion approved no antagonist Details DB00934 Maprotiline approved, investigational no Details DB01426 Ajmaline approved, experimental unknown Details DB00454 Meperidine approved unknown binder Details DB00731 Nateglinide approved, investigational unknown Details DB08867 Ulipristal approved no substrate Details DB05294 Vandetanib approved unknown binder Details DB05521 Telaprevir approved, withdrawn no substrate Details DB05812 Abiraterone approved unknown binder Details DB08881 Vemurafenib approved unknown substrate Details DB08828 Vismodegib approved, investigational unknown binder Details DB08893 Mirabegron approved no binder Details DB08820 Ivacaftor approved no carrier Details DB08860 Pitavastatin approved unknown substrate Details DB08907 Canagliflozin approved unknown substrate Details DB00530 Erlotinib approved, investigational unknown substrate Details DB00472 Fluoxetine approved, vet_approved unknown substrate Details DB00317 Gefitinib approved, investigational unknown substrate Details DB00619 Imatinib approved no binder Details DB00864 Tacrolimus approved, investigational unknown substrate Details DB08931 Riociguat approved unknown substrate Details DB11575 Grazoprevir approved no substrate Details DB01685 Topiroxostat experimental unknown binder Details DB00276 Amsacrine approved, investigational unknown Details DB00396 Progesterone approved, vet_approved unknown binder Details DB00975 Dipyridamole approved unknown Details DB00281 Lidocaine approved, vet_approved unknown Details DB09236 Lacidipine approved, investigational unknown binder Details DB09204 Arotinolol investigational no substrate Details DB09229 Aranidipine experimental no binder Details DB11148 Butamben approved, withdrawn no substrate Details DB11637 Delamanid approved, investigational unknown substrate Details DB00243 Ranolazine approved, investigational no binder Details DB01142 Doxepin approved, investigational no binder Details DB01126 Dutasteride approved, investigational no binder Details DB00343 Diltiazem approved, investigational no binder Details DB00481 Raloxifene approved, investigational no binder Details DB00490 Buspirone approved, investigational unknown binder Details DB12978 Pexidartinib approved, investigational unknown binder Details DB00333 Methadone approved no Details DB01233 Metoclopramide approved, investigational unknown binder Details DB01062 Oxybutynin approved, investigational unknown binder Details DB00661 Verapamil approved unknown substrate Details DB01190 Clindamycin approved, vet_approved unknown substrate Details DB00246 Ziprasidone approved unknown Details DB01264 Darunavir approved unknown substrate Details DB01601 Lopinavir approved unknown substrate Details DB00503 Ritonavir approved, investigational unknown substrate Details DB11642 Pitolisant approved, investigational no binder Details DB00734 Risperidone approved, investigational unknown binder Details DB12674 Lurbinectedin approved, investigational unknown binder Details DB11853 Relugolix approved, investigational unknown binder Details DB15133 Tepotinib approved, investigational unknown binder Details DB00346 Alfuzosin approved, investigational unknown binder Details DB00853 Temozolomide approved, investigational no binder Details DB06237 Avanafil approved unknown binder Details DB00080 Daptomycin approved, investigational no binder Details DB12235 Estetrol approved, investigational unknown binder Details DB01627 Lincomycin approved, vet_approved no binder Details DB16703 Belumosudil approved, investigational no binder Details DB00877 Sirolimus approved, investigational no binder Details DB06234 Maribavir approved, investigational no binder Details DB09074 Olaparib approved unknown binder Details DB00220 Nelfinavir approved no binder Details DB00296 Ropivacaine approved no binder Details DB00572 Atropine approved, vet_approved unknown binder Details DB15149 Futibatinib approved, investigational no binder Details DB11739 Vonoprazan approved, investigational unknown binder Details DB05239 Cobimetinib approved, investigational no binder Details DB00363 Clozapine approved no binder Details DB00349 Clobazam approved, illicit no binder Details DB00683 Midazolam approved, illicit no binder Details DB09128 Brexpiprazole approved, investigational no substrate Details DB08906 Fluticasone furoate approved no binder Details DB09076 Umeclidinium approved unknown binder Details DB01042 Melphalan approved unknown binder Details DB08903 Bedaquiline approved no binder Details DB16200 Iptacopan approved, investigational yes binder Details DB00477 Chlorpromazine approved, investigational, vet_approved unknown binder Details DB01041 Thalidomide approved, investigational, withdrawn yes binder Details DB09262 Imidafenacin investigational no substrate Details DB11828 Neratinib approved, investigational no substrate Details DB00512 Vancomycin approved no substrate Details DB12001 Abemaciclib approved, investigational unknown binder Details DB09053 Ibrutinib approved no substrate Details DB11641 Vinflunine approved, investigational no substrate Details DB14582 Patisiran approved, investigational unknown ligand Details DB00289 Atomoxetine approved no binder Details DB00332 Ipratropium approved, experimental no binder Details DB00404 Alprazolam approved, illicit, investigational unknown binder Details DB00421 Spironolactone approved unknown binder Details DB00476 Duloxetine approved unknown ligand Details DB00497 Oxycodone approved, illicit, investigational unknown binder Details DB00813 Fentanyl approved, illicit, investigational, vet_approved unknown binder Details DB01029 Irbesartan approved, investigational unknown binder Details DB01591 Solifenacin approved unknown binder Details DB00598 Labetalol approved unknown substrate Details DB01203 Nadolol approved unknown binder Details DB01611 Hydroxychloroquine approved unknown binder Details DB01045 Rifampin approved unknown binder Details DB11757 Istradefylline approved, investigational unknown binder Details DB01195 Flecainide approved, withdrawn unknown binder Details DB00278 Argatroban approved, investigational unknown binder Details DB06216 Asenapine approved unknown binder Details DB01072 Atazanavir approved, investigational no binder Details DB11703 Acalabrutinib approved, investigational unknown binder Details DB00857 Terbinafine approved, investigational, vet_approved unknown binder Details DB00950 Fexofenadine approved, investigational unknown substrate Details DB01115 Nifedipine approved unknown binder Details DB00938 Salmeterol approved unknown binder Details DB00608 Chloroquine approved, investigational, vet_approved unknown binder Details DB12466 Favipiravir approved, investigational unknown carrier Details DB00907 Cocaine approved, illicit unknown binder Details DB11689 Selumetinib approved, investigational unknown carrier Details DB14840 Ripretinib approved unknown binder Details DB00808 Indapamide approved unknown binder Details DB00409 Remoxipride approved, withdrawn unknown binder Details DB00960 Pindolol approved, investigational unknown binder Details DB01086 Benzocaine approved, investigational unknown binder Details DB00986 Glycopyrronium approved, investigational, vet_approved unknown binder Details DB08932 Macitentan approved no binder Details DB00342 Terfenadine approved, withdrawn unknown binderregulator Details DB00748 Carbinoxamine approved unknown binderregulator Details DB08865 Crizotinib approved, investigational unknown binder Details DB08930 Dolutegravir approved no binder Details DB12147 Erdafitinib approved, investigational no binder Details DB11978 Glasdegib approved, investigational no binder Details DB12005 Nirogacestat approved, investigational no binder Details