Glucan 1,3-beta-glucosidase
Details
- Name
- Glucan 1,3-beta-glucosidase
- Synonyms
- 2.4.1.-
- EXG
- EXG1
- Exo-1,3-beta-glucanase
- XOG
- Gene Name
- XOG1
- Organism
- Yeast
- Amino acid sequence
>lcl|BSEQ0016396|Glucan 1,3-beta-glucosidase MQLSFILTSSVFILLLEFVKASVISNPFKPNGNLKFKRGGGHNVAWDYDNNVIRGVNLGG WFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQ ISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQN GFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDK LKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGE LSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPY IGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNG LFPQPVTDRQFPNQCGFH
- Number of residues
- 438
- Molecular Weight
- 50037.635
- Theoretical pI
- 5.37
- GO Classification
- Functionscell adhesion molecule binding / glucan exo-1,3-beta-glucosidase activity / transferase activityProcessescell-substrate adhesion / cellular glucan metabolic process / fungal-type cell wall beta-glucan biosynthetic process / fungal-type cell wall organization / glucan catabolic process / pathogenesis / single-species biofilm formation in or on host organism / single-species biofilm formation on inanimate substrateComponentscell surface / extracellular region / fungal-type cell wall
- General Function
- Transferase activity
- Specific Function
- Major glucan 1,3-beta-glucosidase required for cell wall integrity. Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. Can also function biosynthetically as a transglycosylase. Functions to deliver glucan from the cell to the extracellular matrix. Does not appear to impact cell wall glucan content of biofilm cells, nor is it necessary for filamentation or biofilm formation. Involved in cell-substrate and cell-cell adhesion. Adhesion to host-cell surfaces is the first critical step during mucosal infection. XOG1 is target of human antimicrobial peptide LL-37 for inhibition of cell adhesion.
- Pfam Domain Function
- Cellulase (PF00150)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0016397|Glucan 1,3-beta-glucosidase (XOG1) ATGCAGTTATCATTTATCTTAACATCATCGGTATTTATATTATTGCTTGAATTTGTTAAA GCCCTGGTTATTTCTAATCCATTTAAACCAAATGGAAACTTGAAATTCAAGAGAGGAGGC GGACATAATGTTGCTTGGGATTATGATAATAATGTTATCAGAGGTGTCAATTTGGGTGGT TGGTTTGTCCTTGAACCATATATGACACCATCACTTTTTGAACCATTCCAAAATGGAAAT GATCAGTCTGGAGTTCCAGTTGACGAATATCACTGGACACAAACTTTGGGTAAGGAAGCT GCTCTGAGAATTTTGCAAAAACATTGGAGTACTTGGATCACTGAACAAGACTTTAAACAA ATTAGTAATTTGGGATTGAACTTTGTTCGTATTCCTATTGGTTATTGGGCTTTCCAATTG TTGGATAATGATCCATACGTCCAAGGTCAAGTTCAGTATTTGGAAAAGGCTTTGGGCTGG GCCAGAAAGAATAATATCAGAGTTTGGATTGATTTGCACGGTGCACCAGGCTCTCAAAAT GGGTTTGACAACTCCGGTTTAAGAGATAGCTACAATTTCCAAAACGGTGATAACACCCAA GTTACTTTGAATGTATTGAATACTATTTTCAAAAAGTATGGTGGCAACGAATACTCTGAC GTTGTTATTGGTATTGAATTGCTTAATGAACCATTGGGTCCAGTTTTGAATATGGATAAA TTGAAACAATTTTTCTTGGATGGTTACAACTCTCTTAGACAAACTGGATCAGTCACCCCA GTTATCATTCACGATGCTTTCCAAGTCTTTGGCTATTGGAATAACTTTTTGACTGTTGCT GAAGGTCAATGGAATGTTGTTGTTGACCATCATCATTACCAAGTGTTTTCCGGTGGTGAA TTATCTCGTAACATTAACGACCACATTTCAGTTGCTTGTAACTGGGGTTGGGATGCTAAA AAGGAATCCCATTGGAACGTCGCTGGTGAATGGTCTGCTGCTTTGACAGATTGTGCTAAA TGGTTGAATGGTGTCAACAGAGGAGCACGTTATGAGGGTGCTTACGATAATGCTCCATAC ATTGGATCCTGTCAACCAATGTTGGATATTTCCCAATGGTCTGATGAACACAAAACCGAC ACAAGAAGATACATTGAGGCTCAATTGGATGCTTTTGAATACACTGGAGGCTGGGTCTTC TGGAGTTGGAAGACTGAAAATGCCCCTGAATGGAGTTTCCAAACCTTGACTTACAATGGT CTTTTCCCACAACCAGTTACTGATAGACAATTCCCAAACCAATGTGGCTTTCACTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P29717 UniProtKB Entry Name EXG1_CANAL GenBank Protein ID 578126 GenBank Gene ID X56556 - General References
- Chambers RS, Broughton MJ, Cannon RD, Carne A, Emerson GW, Sullivan PA: An exo-beta-(1,3)-glucanase of Candida albicans: purification of the enzyme and molecular cloning of the gene. J Gen Microbiol. 1993 Feb;139(2):325-34. [Article]
- Jones T, Federspiel NA, Chibana H, Dungan J, Kalman S, Magee BB, Newport G, Thorstenson YR, Agabian N, Magee PT, Davis RW, Scherer S: The diploid genome sequence of Candida albicans. Proc Natl Acad Sci U S A. 2004 May 11;101(19):7329-34. Epub 2004 May 3. [Article]
- Luna-Arias JP, Andaluz E, Ridruejo JC, Olivero I, Larriba G: The major exoglucanase from Candida albicans: a non-glycosylated secretory monomer related to its counterpart from Saccharomyces cerevisiae. Yeast. 1991 Nov;7(8):833-41. [Article]
- Mackenzie LF, Brooke GS, Cutfield JF, Sullivan PA, Withers SG: Identification of Glu-330 as the catalytic nucleophile of Candida albicans exo-beta-(1,3)-glucanase. J Biol Chem. 1997 Feb 7;272(6):3161-7. [Article]
- Stubbs HJ, Brasch DJ, Emerson GW, Sullivan PA: Hydrolase and transferase activities of the beta-1,3-exoglucanase of Candida albicans. Eur J Biochem. 1999 Aug;263(3):889-95. [Article]
- Lee CM, Nantel A, Jiang L, Whiteway M, Shen SH: The serine/threonine protein phosphatase SIT4 modulates yeast-to-hypha morphogenesis and virulence in Candida albicans. Mol Microbiol. 2004 Feb;51(3):691-709. [Article]
- Brown V, Sexton JA, Johnston M: A glucose sensor in Candida albicans. Eukaryot Cell. 2006 Oct;5(10):1726-37. [Article]
- Maddi A, Bowman SM, Free SJ: Trifluoromethanesulfonic acid-based proteomic analysis of cell wall and secreted proteins of the ascomycetous fungi Neurospora crassa and Candida albicans. Fungal Genet Biol. 2009 Oct;46(10):768-81. doi: 10.1016/j.fgb.2009.06.005. Epub 2009 Jun 23. [Article]
- Li X, Du W, Zhao J, Zhang L, Zhu Z, Jiang L: The MAP kinase-activated protein kinase Rck2p regulates cellular responses to cell wall stresses, filamentation and virulence in the human fungal pathogen Candida albicans. FEMS Yeast Res. 2010 Jun;10(4):441-51. doi: 10.1111/j.1567-1364.2010.00626.x. Epub 2010 Mar 12. [Article]
- Hernaez ML, Ximenez-Embun P, Martinez-Gomariz M, Gutierrez-Blazquez MD, Nombela C, Gil C: Identification of Candida albicans exposed surface proteins in vivo by a rapid proteomic approach. J Proteomics. 2010 May 7;73(7):1404-9. doi: 10.1016/j.jprot.2010.02.008. Epub 2010 Feb 16. [Article]
- Kelly J, Kavanagh K: Proteomic analysis of proteins released from growth-arrested Candida albicans following exposure to caspofungin. Med Mycol. 2010 Jun;48(4):598-605. doi: 10.3109/13693780903405782. [Article]
- Sorgo AG, Heilmann CJ, Dekker HL, Brul S, de Koster CG, Klis FM: Mass spectrometric analysis of the secretome of Candida albicans. Yeast. 2010 Aug;27(8):661-72. doi: 10.1002/yea.1775. [Article]
- Sorgo AG, Heilmann CJ, Dekker HL, Bekker M, Brul S, de Koster CG, de Koning LJ, Klis FM: Effects of fluconazole on the secretome, the wall proteome, and wall integrity of the clinical fungus Candida albicans. Eukaryot Cell. 2011 Aug;10(8):1071-81. doi: 10.1128/EC.05011-11. Epub 2011 May 27. [Article]
- Tsai PW, Yang CY, Chang HT, Lan CY: Characterizing the role of cell-wall beta-1,3-exoglucanase Xog1p in Candida albicans adhesion by the human antimicrobial peptide LL-37. PLoS One. 2011;6(6):e21394. doi: 10.1371/journal.pone.0021394. Epub 2011 Jun 21. [Article]
- Taff HT, Nett JE, Zarnowski R, Ross KM, Sanchez H, Cain MT, Hamaker J, Mitchell AP, Andes DR: A Candida biofilm-induced pathway for matrix glucan delivery: implications for drug resistance. PLoS Pathog. 2012;8(8):e1002848. doi: 10.1371/journal.ppat.1002848. Epub 2012 Aug 2. [Article]
- Heilmann CJ, Sorgo AG, Mohammadi S, Sosinska GJ, de Koster CG, Brul S, de Koning LJ, Klis FM: Surface stress induces a conserved cell wall stress response in the pathogenic fungus Candida albicans. Eukaryot Cell. 2013 Feb;12(2):254-64. doi: 10.1128/EC.00278-12. Epub 2012 Dec 14. [Article]
- Rohm M, Lindemann E, Hiller E, Ermert D, Lemuth K, Trkulja D, Sogukpinar O, Brunner H, Rupp S, Urban CF, Sohn K: A family of secreted pathogenesis-related proteins in Candida albicans. Mol Microbiol. 2013 Jan;87(1):132-51. doi: 10.1111/mmi.12087. Epub 2012 Dec 10. [Article]
- Cutfield SM, Davies GJ, Murshudov G, Anderson BF, Moody PC, Sullivan PA, Cutfield JF: The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases. J Mol Biol. 1999 Dec 3;294(3):771-83. [Article]
- Patrick WM, Nakatani Y, Cutfield SM, Sharpe ML, Ramsay RJ, Cutfield JF: Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance. FEBS J. 2010 Nov;277(21):4549-61. doi: 10.1111/j.1742-4658.2010.07869.x. Epub 2010 Sep 28. [Article]