Cholecystokinin
Details
- Name
- Cholecystokinin
- Synonyms
- CCK
- Gene Name
- CCK
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0052399|Cholecystokinin MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGA LLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
- Number of residues
- 115
- Molecular Weight
- 12669.26
- Theoretical pI
- Not Available
- GO Classification
- Functionshormone activity / neuropeptide hormone activity / peptide hormone receptor bindingProcessesactivation of cysteine-type endopeptidase activity involved in apoptotic process / axonogenesis / digestion / eating behavior / G protein-coupled receptor signaling pathway / memory / negative regulation of appetite / negative regulation of behavioral fear response / negative regulation of eating behavior / neuron migration / positive regulation of behavioral fear response / positive regulation of cell population proliferation / positive regulation of glutamate secretion / positive regulation of mitochondrial depolarization / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of protein-containing complex assembly / positive regulation of sensory perception of pain / protein kinase C-activating G protein-coupled receptor signaling pathway / release of cytochrome c from mitochondria / signal transduction / visual learningComponentsaxon / axon hillock / axon initial segment / dendrite / extracellular region / extracellular space / perikaryon / terminal bouton
- General Function
- This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
- Specific Function
- Hormone activity
- Pfam Domain Function
- Gastrin (PF00918)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0052400|Cholecystokinin (CCK) ATGAACAGCGGCGTGTGCCTGTGCGTGCTGATGGCGGTACTGGCGGCTGGCGCCCTGACG CAGCCGGTGCCTCCCGCAGATCCCGCGGGCTCCGGGCTGCAGCGGGCAGAGGAGGCGCCC CGTAGGCAGCTGAGGGTATCGCAGAGAACGGATGGCGAGTCCCGAGCGCACCTGGGCGCC CTGCTGGCAAGATACATCCAGCAGGCCCGGAAAGCTCCTTCTGGACGAATGTCCATCGTT AAGAACCTGCAGAACCTGGACCCCAGCCACAGGATAAGTGACCGGGACTACATGGGCTGG ATGGATTTTGGCCGTCGCAGTGCCGAGGAGTATGAGTACCCCTCCTAG
- Chromosome Location
- 3
- Locus
- 3p22.1
- External Identifiers
Resource Link UniProtKB ID P06307 UniProtKB Entry Name CCKN_HUMAN HGNC ID HGNC:1569 - General References
- Takahashi Y, Kato K, Hayashizaki Y, Wakabayashi T, Ohtsuka E, Matsuki S, Ikehara M, Matsubara K: Molecular cloning of the human cholecystokinin gene by use of a synthetic probe containing deoxyinosine. Proc Natl Acad Sci U S A. 1985 Apr;82(7):1931-5. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Vishnuvardhan D, Beinfeld MC: Role of tyrosine sulfation and serine phosphorylation in the processing of procholecystokinin to amidated cholecystokinin and its secretion in transfected AtT-20 cells. Biochemistry. 2000 Nov 14;39(45):13825-30. [Article]