Metallothionein-1F
Details
- Name
- Metallothionein-1F
- Synonyms
- Metallothionein-IF
- MT-1F
- MT-IF
- Gene Name
- MT1F
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0049454|Metallothionein-1F MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC D
- Number of residues
- 61
- Molecular Weight
- 6086.12
- Theoretical pI
- Not Available
- GO Classification
- Functionszinc ion bindingProcessescellular response to cadmium ion / cellular response to zinc ion / negative regulation of growthComponentscytoplasm / nucleus / perinuclear region of cytoplasm
- General Function
- Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
- Specific Function
- Zinc ion binding
- Pfam Domain Function
- Metallothio (PF00131)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0049455|Metallothionein-1F (MT1F) ATGGACCCCAACTGCTCCTGCGCCGCTGGTGTCTCCTGCACCTGCGCTGGTTCCTGCAAG TGCAAAGAGTGCAAATGCACCTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCCGTGGGC TGTAGCAAGTGTGCCCAGGGCTGTGTTTGCAAAGGGGCGTCAGAGAAGTGCAGCTGCTGC GACTGA
- Chromosome Location
- 16
- Locus
- 16q13
- External Identifiers
Resource Link UniProtKB ID P04733 UniProtKB Entry Name MT1F_HUMAN HGNC ID HGNC:7398 - General References
- Schmidt CJ, Jubier MF, Hamer DH: Structure and expression of two human metallothionein-I isoform genes and a related pseudogene. J Biol Chem. 1985 Jun 25;260(12):7731-7. [Article]
- Varshney U, Jahroudi N, Foster R, Gedamu L: Structure, organization, and regulation of human metallothionein IF gene: differential and cell-type-specific expression in response to heavy metals and glucocorticoids. Mol Cell Biol. 1986 Jan;6(1):26-37. [Article]
- Gedamu L, Varshney U, Jahroudi N, Foster R, Shworak NW: Structure and expression of the human metallothionein genes. Experientia Suppl. 1987;52:361-72. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]