Fimbrial protein
Details
- Name
- Fimbrial protein
- Synonyms
- MS11 antigen
- Pilin
- Gene Name
- pilE1
- Organism
- Neisseria gonorrhoeae
- Amino acid sequence
>lcl|BSEQ0016532|Fimbrial protein MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLN HGKWPENNTSAGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRE NGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK
- Number of residues
- 165
- Molecular Weight
- 17944.29
- Theoretical pI
- 7.4
- GO Classification
- Processescell adhesionComponentspilus
- General Function
- Not Available
- Specific Function
- This protein is the predominant Neisseria surface antigen, which allows adhesion of the bacterium to various host cells.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Fimbrium
- Gene sequence
>lcl|BSEQ0003396|501 bp ATGAATACCCTTCAAAAAGGCTTTACCCTTATCGAGCTGATGATTGTGATCGCTATCGTC GGCATTTTGGCGGCAGTCGCCCTTCCCGCCTACCAAGACTACACCGCCCGCGCGCAAGTT TCCGAAGCCATCCTTTTGGCCGAAGGTCAAAAATCAGCCGTCACCGAGTATTACCTGAAT CACGGCAAATGGCCGGAAAACAACACTTCTGCCGGCGTGGCATCCCCCCCCTCCGACATC AAAGGCAAATATGTTAAAGAGGTTGAAGTTAAAAACGGCGTCGTTACCGCCACAATGCTT TCAAGCGGCGTAAACAATGAAATCAAAGGCAAAAAACTCTCCCTGTGGGCCAGGCGTGAA AACGGTTCGGTAAAATGGTTCTGCGGACAGCCGGTTACGCGCACCGACGACGACACCGTT GCCGACGCCAAAGACGGCAAAGAAATCGACACCAAGCACCTGCCGTCAACCTGCCGCGAT AAGGCATCTGATGCCAAATGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P02974 UniProtKB Entry Name FMM1_NEIGO GenBank Protein ID 150288 GenBank Gene ID K02078 - General References
- Meyer TF, Billyard E, Haas R, Storzbach S, So M: Pilus genes of Neisseria gonorrheae: chromosomal organization and DNA sequence. Proc Natl Acad Sci U S A. 1984 Oct;81(19):6110-4. [Article]
- Bergstrom S, Robbins K, Koomey JM, Swanson J: Piliation control mechanisms in Neisseria gonorrhoeae. Proc Natl Acad Sci U S A. 1986 Jun;83(11):3890-4. [Article]
- Jonsson AB, Nyberg G, Normark S: Phase variation of gonococcal pili by frameshift mutation in pilC, a novel gene for pilus assembly. EMBO J. 1991 Feb;10(2):477-88. [Article]
- Jonsson AB, Pfeifer J, Normark S: Neisseria gonorrhoeae PilC expression provides a selective mechanism for structural diversity of pili. Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3204-8. [Article]
- Hermodson MA, Chen KC, Buchanan TM: Neisseria pili proteins: amino-terminal amino acid sequences and identification of an unusual amino acid. Biochemistry. 1978 Feb 7;17(3):442-5. [Article]
- Schoolnik GK, Fernandez R, Tai JY, Rothbard J, Gotschlich EC: Gonococcal pili. Primary structure and receptor binding domain. J Exp Med. 1984 May 1;159(5):1351-70. [Article]
- Hegge FT, Hitchen PG, Aas FE, Kristiansen H, Lovold C, Egge-Jacobsen W, Panico M, Leong WY, Bull V, Virji M, Morris HR, Dell A, Koomey M: Unique modifications with phosphocholine and phosphoethanolamine define alternate antigenic forms of Neisseria gonorrhoeae type IV pili. Proc Natl Acad Sci U S A. 2004 Jul 20;101(29):10798-803. Epub 2004 Jul 12. [Article]
- Aas FE, Egge-Jacobsen W, Winther-Larsen HC, Lovold C, Hitchen PG, Dell A, Koomey M: Neisseria gonorrhoeae type IV pili undergo multisite, hierarchical modifications with phosphoethanolamine and phosphocholine requiring an enzyme structurally related to lipopolysaccharide phosphoethanolamine transferases. J Biol Chem. 2006 Sep 22;281(38):27712-23. Epub 2006 Jul 5. [Article]
- Parge HE, Forest KT, Hickey MJ, Christensen DA, Getzoff ED, Tainer JA: Structure of the fibre-forming protein pilin at 2.6 A resolution. Nature. 1995 Nov 2;378(6552):32-8. [Article]
- Forest KT, Dunham SA, Koomey M, Tainer JA: Crystallographic structure reveals phosphorylated pilin from Neisseria: phosphoserine sites modify type IV pilus surface chemistry and fibre morphology. Mol Microbiol. 1999 Feb;31(3):743-52. [Article]
- Craig L, Volkmann N, Arvai AS, Pique ME, Yeager M, Egelman EH, Tainer JA: Type IV pilus structure by cryo-electron microscopy and crystallography: implications for pilus assembly and functions. Mol Cell. 2006 Sep 1;23(5):651-62. [Article]