Aminoglycoside 3'-phosphotransferase
Details
- Name
- Aminoglycoside 3'-phosphotransferase
- Synonyms
- 2.7.1.95
- APH(3')-I
- APH(3')I
- Kanamycin kinase, type I
- Neomycin-kanamycin phosphotransferase type I
- nptI
- Gene Name
- aphA1
- Organism
- Escherichia coli
- Amino acid sequence
>lcl|BSEQ0022078|Aminoglycoside 3'-phosphotransferase MSHIQRETSCSRPRLNSNLDADLYGYKWARDNVGQSGATIYRLYGKPDAPELFLKHGKGS VANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENI VDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWK EMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFS PSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
- Number of residues
- 271
- Molecular Weight
- 30960.85
- Theoretical pI
- 5.02
- GO Classification
- FunctionsATP binding / kanamycin kinase activityProcessesresponse to antibiotic
- General Function
- Kanamycin kinase activity
- Specific Function
- Resistance to kanamycin and structurally-related aminoglycosides, including amikacin.
- Pfam Domain Function
- APH (PF01636)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0006836|345 bp ATGTGTTTTACTGTCAACGGCGAGATGCAGCTTACGCCAGATACGGCGGCGTTCCTGGCC ATGCTTTTTGACTTTCCATTCGCCTTCACCAAAGACCTTCAGCCCGGTGGAATCAATCAC CAGATGCGCGATTTCACCCCGGGTGAACGTTTTGAAACTGATATTAACCGACTTTGCCCG CCTGCTGACACAGCTGTAATCCGGGCAGCGCAACGGAACATTCATCAGTGTAAAAATGGA ATCAATAAAGCCCTGCGCAGCGCGCAGGGTCAGCCTGAATACGCGTTTAATGACCAGCAC AGTCGTGATGGCAAGGTCAGAATAGCGCTGAGGTCTGCCTCGTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00551 UniProtKB Entry Name KKA1_ECOLX GenBank Protein ID 43026 GenBank Gene ID V00359 - General References
- Oka A, Sugisaki H, Takanami M: Nucleotide sequence of the kanamycin resistance transposon Tn903. J Mol Biol. 1981 Apr 5;147(2):217-26. [Article]
- Vakulenko S, Kalman M, Horvath B, Simoncsits A: The nucleotide sequence of an aminoglycoside 3'-phosphotransferase gene from E. coli. Nucleic Acids Res. 1987 Oct 12;15(19):8111. [Article]
- Mochida S, Tsuchiya H, Mori K, Kaji A: Three short fragments of Rts1 DNA are responsible for the temperature-sensitive growth phenotype (Tsg) of host bacteria. J Bacteriol. 1991 Apr;173(8):2600-7. [Article]
- Menard R, Molinas C, Arthur M, Duval J, Courvalin P, Leclercq R: Overproduction of 3'-aminoglycoside phosphotransferase type I confers resistance to tobramycin in Escherichia coli. Antimicrob Agents Chemother. 1993 Jan;37(1):78-83. [Article]
- Grindley ND, Joyce CM: Genetic and DNA sequence analysis of the kanamycin resistance transposon Tn903. Proc Natl Acad Sci U S A. 1980 Dec;77(12):7176-80. [Article]
- Grindley ND, Joyce CM: Analysis of the structure and function of the kanamycin-resistance transposon Tn903. Cold Spring Harb Symp Quant Biol. 1981;45 Pt 1:125-33. [Article]
- Heidekamp F, Baas PD, van Boom JH, Veeneman GH, Zipursky SL, Jansz HS: Construction and characterization of recombinant plasmid DNAs containing sequences of the origin of bacteriophage phi X174 DNA replication. Nucleic Acids Res. 1981 Jul 24;9(14):3335-54. [Article]