Potassium channel subfamily K member 1
Details
- Name
- Potassium channel subfamily K member 1
- Synonyms
- HOHO1
- Inward rectifying potassium channel protein TWIK-1
- KCNO1
- Potassium channel K2P1
- Potassium channel KCNO1
- TWIK1
- Gene Name
- KCNK1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0009972|Potassium channel subfamily K member 1 MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
- Number of residues
- 336
- Molecular Weight
- 38142.775
- Theoretical pI
- 6.34
- GO Classification
- Functionsinward rectifier potassium channel activity / potassium channel activity / potassium ion leak channel activity / sodium channel activityProcessespotassium ion transmembrane transport / potassium ion transport / regulation of resting membrane potential / sodium ion transmembrane transport / stabilization of membrane potential / synaptic transmissionComponentsapical plasma membrane / cell junction / cytoplasmic membrane-bounded vesicle / dendrite / integral component of membrane / integral component of plasma membrane / inward rectifier potassium channel complex / perikaryon / plasma membrane / potassium channel complex / recycling endosome / synapse / voltage-gated potassium channel complex
- General Function
- Sodium channel activity
- Specific Function
- Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues (PubMed:15820677, PubMed:21653227). Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K(+) ions at physiological potassium concentrations and at neutral pH, but becomes permeable to Na(+) at subphysiological K(+) levels and upon acidification of the extracellular medium (PubMed:21653227, PubMed:22431633). The homodimer has very low potassium channel activity, when expressed in heterologous systems, and can function as weakly inward rectifying potassium channel (PubMed:8605869, PubMed:8978667, PubMed:15820677, PubMed:21653227, PubMed:22431633, PubMed:23169818, PubMed:25001086). Channel activity is modulated by activation of serotonin receptors (By similarity). Heterodimeric channels containing KCNK1 and KCNK2 have much higher activity, and may represent the predominant form in astrocytes (By similarity). Heterodimeric channels containing KCNK1 and KCNK3 or KCNK9 have much higher activity (PubMed:23169818). Heterodimeric channels formed by KCNK1 and KCNK9 may contribute to halothane-sensitive currents (PubMed:23169818). Mediates outward rectifying potassium currents in dentate gyrus granule cells and contributes to the regulation of their resting membrane potential (By similarity). Contributes to the regulation of action potential firing in dentate gyrus granule cells and down-regulates their intrinsic excitability (By similarity). In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (By similarity). Required for normal ion and water transport in the kidney (By similarity). Contributes to the regulation of the resting membrane potential of pancreatic beta cells (By similarity). The low channel activity of homodimeric KCNK1 may be due to sumoylation (PubMed:15820677, PubMed:20498050, PubMed:23169818). The low channel activity may be due to rapid internalization from the cell membrane and retention in recycling endosomes (PubMed:19959478).
- Pfam Domain Function
- Ion_trans_2 (PF07885)
- Transmembrane Regions
- 21-41 133-156 182-202 244-267
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0009973|Potassium channel subfamily K member 1 (KCNK1) ATGCTGCAGTCCCTGGCCGGCAGCTCGTGCGTGCGCCTGGTGGAGCGGCACCGCTCGGCC TGGTGCTTCGGCTTCCTGGTGCTGGGCTACTTGCTCTACCTGGTCTTCGGCGCAGTGGTC TTCTCCTCGGTGGAGCTGCCCTATGAGGACCTGCTGCGCCAGGAGCTGCGCAAGCTGAAG CGACGCTTCTTGGAGGAGCACGAGTGCCTGTCTGAGCAGCAGCTGGAGCAGTTCCTGGGC CGGGTGCTGGAGGCCAGCAACTACGGCGTGTCGGTGCTCAGCAACGCCTCGGGCAACTGG AACTGGGACTTCACCTCCGCGCTCTTCTTCGCCAGCACCGTGCTCTCCACCACAGGTTAT GGCCACACCGTGCCCTTGTCAGATGGAGGTAAGGCCTTCTGCATCATCTACTCCGTCATT GGCATTCCCTTCACCCTCCTGTTCCTGACGGCTGTGGTCCAGCGCATCACCGTGCACGTC ACCCGCAGGCCGGTCCTCTACTTCCACATCCGCTGGGGCTTCTCCAAGCAGGTGGTGGCC ATCGTCCATGCCGTGCTCCTTGGGTTTGTCACTGTGTCCTGCTTCTTCTTCATCCCGGCC GCTGTCTTCTCAGTCCTGGAGGATGACTGGAACTTCCTGGAATCCTTTTATTTTTGTTTT ATTTCCCTGAGCACCATTGGCCTGGGGGATTATGTGCCTGGGGAAGGCTACAATCAAAAA TTCAGAGAGCTCTATAAGATTGGGATCACGTGTTACCTGCTACTTGGCCTTATTGCCATG TTGGTAGTTCTGGAAACCTTCTGTGAACTCCATGAGCTGAAAAAATTCAGAAAAATGTTC TATGTGAAGAAGGACAAGGACGAGGATCAGGTGCACATCATAGAGCATGACCAACTGTCC TTCTCCTCGATCACAGACCAGGCAGCTGGCATGAAAGAGGACCAGAAGCAAAATGAGCCT TTTGTGGCCACCCAGTCATCTGCCTGCGTGGATGGCCCTGCAAACCATTGA
- Chromosome Location
- 1
- Locus
- 1q42-q43
- External Identifiers
Resource Link UniProtKB ID O00180 UniProtKB Entry Name KCNK1_HUMAN GenBank Protein ID 1086491 GenBank Gene ID U33632 GenAtlas ID KCNK1 HGNC ID HGNC:6272 - General References
- Lesage F, Guillemare E, Fink M, Duprat F, Lazdunski M, Romey G, Barhanin J: TWIK-1, a ubiquitous human weakly inward rectifying K+ channel with a novel structure. EMBO J. 1996 Mar 1;15(5):1004-11. [Article]
- Goldstein SA, Wang KW, Ilan N, Pausch MH: Sequence and function of the two P domain potassium channels: implications of an emerging superfamily. J Mol Med (Berl). 1998 Jan;76(1):13-20. [Article]
- Orias M, Velazquez H, Tung F, Lee G, Desir GV: Cloning and localization of a double-pore K channel, KCNK1: exclusive expression in distal nephron segments. Am J Physiol. 1997 Oct;273(4 Pt 2):F663-6. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Lesage F, Reyes R, Fink M, Duprat F, Guillemare E, Lazdunski M: Dimerization of TWIK-1 K+ channel subunits via a disulfide bridge. EMBO J. 1996 Dec 2;15(23):6400-7. [Article]
- Medhurst AD, Rennie G, Chapman CG, Meadows H, Duckworth MD, Kelsell RE, Gloger II, Pangalos MN: Distribution analysis of human two pore domain potassium channels in tissues of the central nervous system and periphery. Brain Res Mol Brain Res. 2001 Jan 31;86(1-2):101-14. [Article]
- Rajan S, Plant LD, Rabin ML, Butler MH, Goldstein SA: Sumoylation silences the plasma membrane leak K+ channel K2P1. Cell. 2005 Apr 8;121(1):37-47. [Article]
- Feliciangeli S, Bendahhou S, Sandoz G, Gounon P, Reichold M, Warth R, Lazdunski M, Barhanin J, Lesage F: Does sumoylation control K2P1/TWIK1 background K+ channels? Cell. 2007 Aug 10;130(3):563-9. [Article]
- Gaborit N, Le Bouter S, Szuts V, Varro A, Escande D, Nattel S, Demolombe S: Regional and tissue specific transcript signatures of ion channel genes in the non-diseased human heart. J Physiol. 2007 Jul 15;582(Pt 2):675-93. Epub 2007 May 3. [Article]
- Feliciangeli S, Tardy MP, Sandoz G, Chatelain FC, Warth R, Barhanin J, Bendahhou S, Lesage F: Potassium channel silencing by constitutive endocytosis and intracellular sequestration. J Biol Chem. 2010 Feb 12;285(7):4798-805. doi: 10.1074/jbc.M109.078535. Epub 2009 Dec 3. [Article]
- Plant LD, Dementieva IS, Kollewe A, Olikara S, Marks JD, Goldstein SA: One SUMO is sufficient to silence the dimeric potassium channel K2P1. Proc Natl Acad Sci U S A. 2010 Jun 8;107(23):10743-8. doi: 10.1073/pnas.1004712107. Epub 2010 May 24. [Article]
- Ma L, Zhang X, Chen H: TWIK-1 two-pore domain potassium channels change ion selectivity and conduct inward leak sodium currents in hypokalemia. Sci Signal. 2011 Jun 7;4(176):ra37. doi: 10.1126/scisignal.2001726. [Article]
- Zhao KQ, Xiong G, Wilber M, Cohen NA, Kreindler JL: A role for two-pore K(+) channels in modulating Na(+) absorption and Cl(-) secretion in normal human bronchial epithelial cells. Am J Physiol Lung Cell Mol Physiol. 2012 Jan 1;302(1):L4-L12. doi: 10.1152/ajplung.00102.2011. Epub 2011 Sep 30. [Article]
- Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [Article]
- Chatelain FC, Bichet D, Douguet D, Feliciangeli S, Bendahhou S, Reichold M, Warth R, Barhanin J, Lesage F: TWIK1, a unique background channel with variable ion selectivity. Proc Natl Acad Sci U S A. 2012 Apr 3;109(14):5499-504. doi: 10.1073/pnas.1201132109. Epub 2012 Mar 19. [Article]
- Plant LD, Zuniga L, Araki D, Marks JD, Goldstein SA: SUMOylation silences heterodimeric TASK potassium channels containing K2P1 subunits in cerebellar granule neurons. Sci Signal. 2012 Nov 20;5(251):ra84. doi: 10.1126/scisignal.2003431. [Article]
- Feliciangeli S, Chatelain FC, Bichet D, Lesage F: The family of K2P channels: salient structural and functional properties. J Physiol. 2015 Jun 15;593(12):2587-603. doi: 10.1113/jphysiol.2014.287268. Epub 2015 Jan 22. [Article]
- Aryal P, Abd-Wahab F, Bucci G, Sansom MS, Tucker SJ: A hydrophobic barrier deep within the inner pore of the TWIK-1 K2P potassium channel. Nat Commun. 2014 Jul 8;5:4377. doi: 10.1038/ncomms5377. [Article]
- Bichet D, Blin S, Feliciangeli S, Chatelain FC, Bobak N, Lesage F: Silent but not dumb: how cellular trafficking and pore gating modulate expression of TWIK1 and THIK2. Pflugers Arch. 2015 May;467(5):1121-31. doi: 10.1007/s00424-014-1631-y. Epub 2014 Oct 24. [Article]
- Miller AN, Long SB: Crystal structure of the human two-pore domain potassium channel K2P1. Science. 2012 Jan 27;335(6067):432-6. doi: 10.1126/science.1213274. [Article]