Nivolumab
Identification
- Summary
Nivolumab is a PD-1 blocking antibody used to treat melanoma, non small-cell lung cancer, renal cell cancer, head and neck cancer, and Hodgkin lymphoma.
- Brand Names
- Opdivo, Opdualag
- Generic Name
- Nivolumab
- DrugBank Accession Number
- DB09035
- Background
Nivolumab is a fully human IgG4 antibody targeting the immune checkpoint programmed death receptor-1 (PD-1).6 This antibody was produced entirely in mice and grafted onto human kappa and IgG4 Fc region with the mutation S228P for additional stability and reduced variability.5 It was developed by Bristol Myers Squibb.6
Nivolumab was granted FDA approval on 22 December 2014.6 It is also available in combination with relatlimab under the brand name Opdualag.11,13,14
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
- Protein Based Therapies
Monoclonal antibody (mAb) - Protein Structure
- Protein Chemical Formula
- C6362H9862N1712O1995S42
- Protein Average Weight
- 143597.3811 Da
- Sequences
>Heavy Chain Sequence QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV MHEALHNHYTQKSLSLSLGK
>Light Chain Sequence EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format- Synonyms
- Nivolumab
- External IDs
- BMS 936558
- BMS-936558
- GTPL7335
- MDX 1106
- MDX-1106
- ONO 4538
- ONO-4538
Pharmacology
- Indication
Nivolumab is indicated to treat unresectable or metastatic melanoma, melanoma as adjuvant treatment, resectable or metastatic non-small cell lung cancer, small cell lung cancer, advanced renal cell carcinoma, classical Hodgkin lymphoma, squamous cell carcinoma of the head and neck, urothelial carcinoma, microsatellite instability-high or mismatch repair deficient metastatic colorectal cancer, hepatocellular carcinoma, and esophageal cancer.6,9 The indication for classical Hodgkin lymphoma, microsatellite instability-high or mismatch repair deficient metastatic colorectal cancer, and hepatocellular carcinoma were approved under accelerated approval based on the overall response rate. Continued approval for this indication may be contingent upon verification and description of clinical benefit in confirmatory trials.6
Nivolumab is also approved for the treatment of HER2-negative advanced or metastatic gastric, gastroesophageal junction, or esophageal adenocarcinoma when used in combination with a fluoropyrimidine- and platinum-containing chemotherapy regimen.8
In combination with relatlimab, nivolumab is indicated for the treatment of patients ≥12 years old with unresectable or metastatic melanoma.11,13,14
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
Indication Type Indication Combined Product Details Approval Level Age Group Patient Characteristics Dose Form Used in combination to treat Advanced esophageal adenocarcinoma •••••••••••• ••••• ••••••••• Used as adjunct in combination to treat Advanced esophageal adenocarcinoma •••••••••••• ••••• ••••••••• Used as adjunct in combination to treat Advanced esophageal adenocarcinoma •••••••••••• ••••••••• Used in combination to treat Advanced gastric adenocarcinoma •••••••••••• ••••• ••••••••• Used as adjunct in combination to treat Advanced gastric adenocarcinoma •••••••••••• ••••• ••••••••• - Associated Therapies
- Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
Nivolumab blocks PD-1 inhibitory signalling to T-cells.6 It has a long duration of action as it is administered every 2-4 weeks.6 Patients should be counselled regarding the risk of immune-mediated adverse effects, infusion-related adverse effects, complications of allogenic hematopoietic stem cell transplants, embryo-fetal toxicity.6
- Mechanism of action
The ligands PD-L1 and PD-L2 bind to the PD-1 receptor on T-cells, inhibiting the action of these cells.6 Tumor cells express PD-L1 and PD-L2.6 Nivolumab binds to PD-1, preventing PD-L1 and PD-L2 from inhibiting the action of T-cells, restoring a patient's tumor-specific T-cell response.1
Target Actions Organism AProgrammed cell death protein 1 inhibitorantibodyHumans UProgrammed cell death 1 ligand 1 inhibitorantibodyHumans - Absorption
Pharmacokinetic studies have suggested that nivolumab presents linear pharmacokinetics with a dose-proportional increase in peak concentration and AUC. The time to peak plasma concentration ranges between 1-4 hours.1 The absorption pharmacokinetic properties respective to the administration of a dose of 10 mg/kg are reported to be Cmax, Tmax and AUC of 242 µg/kg, 2.99 hours and 68100 µg*h/mL respectively.3
- Volume of distribution
The volume of distribution at steady state when a dose of 10 mg/kg of nivolumab is administered is reported to be 91.1 mL/kg.3 At doses ranging from 0.1 to 20 mg/kg the volume of distribution is reported to be 8L.4
- Protein binding
There is no information regarding the plasma protein binding of nivolumab.7
- Metabolism
There have not been formal studies regarding the specific metabolism of nivolumab but as a human monoclonal antibody, it has been suggested to be degraded to small peptides and individual amino acids.7
- Route of elimination
There have not been studies regarding the specific route of elimination of nivolumab.7
- Half-life
The serum half life of nivolumab is approximately 20 days1 with an elimination half life of 26.7 days.4
- Clearance
The estimated clearance rate of nivolumab is 9.4 mL/h.2 The clearance rate seems to be increased according to body weight.4
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
Data regarding overdoses of nivolumab are not readily available.6 Common adverse effects include Rash, pruritus, cough, upper respiratory tract infection, and peripheral edema.6
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Nivolumab. Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Nivolumab. Aducanumab The risk or severity of adverse effects can be increased when Nivolumab is combined with Aducanumab. Alemtuzumab The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Nivolumab. Alirocumab The risk or severity of adverse effects can be increased when Nivolumab is combined with Alirocumab. - Food Interactions
- No interactions found.
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Nivolumab Bms Injection, solution, concentrate 10 mg/ml Intravenous Bristol Myers Squibb Pharma Eeig 2021-01-12 2016-01-14 EU Nivolumab Bms Injection, solution, concentrate 10 mg/ml Intravenous Bristol Myers Squibb Pharma Eeig 2021-01-12 2016-01-14 EU Opdivo Solution 10 mg / mL Intravenous Bristol Myers Squibb 2015-10-23 Not applicable Canada Opdivo Injection 10 mg/1mL Intravenous E.R. Squibb & Sons, L.L.C. 2017-12-08 Not applicable US Opdivo Injection 10 mg/ml Intravenous Bristol Myers Squibb Pharma Eeig 2020-12-15 Not applicable EU - Mixture Products
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Opdualag Nivolumab (12 mg/ml) + Relatlimab (4 mg/ml) Injection, solution, concentrate Intravenous Bristol Myers Squibb Pharma Eeig 2022-12-02 Not applicable EU Opdualag Nivolumab (240 mg / 20 mL) + Relatlimab (80 mg / 20 mL) Solution Intravenous Bristol Myers Squibb 2024-02-12 Not applicable Canada Opdualag Nivolumab (12 mg/1mL) + Relatlimab (4 mg/1mL) Injection Intravenous E.R. Squibb & Sons, L.L.C. 2022-03-18 Not applicable US
Categories
- ATC Codes
- L01FF01 — Nivolumab
- L01FF — PD-1/PDL-1 (Programmed cell death protein 1/death ligand 1) inhibitors
- L01F — MONOCLONAL ANTIBODIES AND ANTIBODY DRUG CONJUGATES
- L01 — ANTINEOPLASTIC AGENTS
- L — ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
- Drug Categories
- Adjuvants, Immunologic
- Amino Acids, Peptides, and Proteins
- Antibodies
- Antibodies, Monoclonal
- Antibodies, Monoclonal, Humanized
- Antineoplastic Agents
- Antineoplastic Agents, Immunological
- Antineoplastic and Immunomodulating Agents
- Blood Proteins
- Cancer immunotherapy
- Globulins
- Immune Checkpoint Inhibitors
- Immunoglobulin G
- Immunoglobulins
- Immunoproteins
- Immunotherapy
- MONOCLONAL ANTIBODIES AND ANTIBODY DRUG CONJUGATES
- PD-1/PDL-1 (Programmed cell death protein 1/death ligand 1) inhibitors
- Programmed Death Receptor-1 Blocking Antibody
- Programmed Death Receptor-1-directed Antibody Interactions
- Proteins
- Serum Globulins
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- 31YO63LBSN
- CAS number
- 946414-94-4
References
- General References
- Brahmer JR, Hammers H, Lipson EJ: Nivolumab: targeting PD-1 to bolster antitumor immunity. Future Oncol. 2015;11(9):1307-26. doi: 10.2217/fon.15.52. Epub 2015 Mar 23. [Article]
- Bajaj G, Wang X, Agrawal S, Gupta M, Roy A, Feng Y: Model-Based Population Pharmacokinetic Analysis of Nivolumab in Patients With Solid Tumors. CPT Pharmacometrics Syst Pharmacol. 2017 Jan;6(1):58-66. doi: 10.1002/psp4.12143. Epub 2016 Dec 26. [Article]
- Lee KW, Lee DH, Kang JH, Park JO, Kim SH, Hong YS, Kim ST, Oh DY, Bang YJ: Phase I Pharmacokinetic Study of Nivolumab in Korean Patients with Advanced Solid Tumors. Oncologist. 2018 Feb;23(2):155-e17. doi: 10.1634/theoncologist.2017-0528. Epub 2017 Nov 20. [Article]
- Solimando DA Jr, Waddell JA: Nivolumab and Olaparib. Hosp Pharm. 2015 May;50(5):356-66. doi: 10.1310/hpj5005-356. [Article]
- Mashima E, Inoue A, Sakuragi Y, Yamaguchi T, Sasaki N, Hara Y, Omoto D, Ohmori S, Haruyama S, Sawada Y, Yoshioka M, Nishio D, Nakamura M: Nivolumab in the treatment of malignant melanoma: review of the literature. Onco Targets Ther. 2015 Aug 6;8:2045-51. doi: 10.2147/OTT.S62102. eCollection 2015. [Article]
- FDA Approved Drug Products: Opdivo (nivolumab) for intravenous injection [Link]
- BC Cancer Agency: Opdivo Monograph [Link]
- Health Canada Product Monograph: Opdivo (nivolumab) for intravenous injection [Link]
- Health Canada Approved Drug Products: OPDIVO (nivolumab) injection for Intravenous Infusion (August 2022) [Link]
- EMA Approved Drug Products: OPDIVO (Nivolumab) solution, for intravenous injection [Link]
- FDA Approved Drug Products: Opdualag (nivolumab and relatlimab-rmbw) injection for intravenous use [Link]
- FDA Approved Drug Products: OPDIVO (nivolumab) injection, for intravenous use (October 2023) [Link]
- EMA EPAR: Opdualag (relatlimab/nivolumab) [Link]
- Health Canada Product Monograph: Opdualag (nivolumab and relatlimab) solution for intravenous injection [Link]
- External Links
- KEGG Drug
- D10316
- PubChem Substance
- 347910393
- 1597876
- ChEMBL
- CHEMBL2108738
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Nivolumab
- FDA label
- Download (2.51 MB)
- MSDS
- Download (1.26 MB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Active Not Recruiting Treatment Non-Small Cell Lung Cancer (NSCLC) 1 4 Completed Other Renal Cell Carcinoma (RCC) 1 4 Completed Treatment Liver Cancer 1 4 Completed Treatment Lung Cancer 1 4 Completed Treatment Non-Small Cell Lung Cancer (NSCLC) / Non-Small Cell Lung Carcinoma / Renal Cancer / Renal Neoplasms 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
Form Route Strength Injection, solution, concentrate Intravenous 10 MG/ML Injection Intravenous 10 mg/ml Injection Intravenous 10 mg/1mL Injection, solution, concentrate Intravenous; Parenteral 10 MG/ML Solution Intravenous 10 mg / mL Solution Intravenous 100.000 mg Solution Intravenous 100 mg/10ml Injection, solution Intravenous Solution Intravenous 40 mg/4ml Solution Intravenous drip 10 mg/mL Solution Intravenous 40 mg Solution Intravenous 100 mg Injection Intravenous Injection, solution, concentrate Intravenous Solution Intravenous Injection, solution, concentrate Intravenous 10 mg/1ml - Prices
- Not Available
- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Region US2013173223 No 2013-05-13 2033-05-13 US
Properties
- State
- Liquid
- Experimental Properties
Property Value Source melting point (°C) 80-90 ºC (based on IgG properties) McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282 boiling point (°C) Fab and Fc domains denaturates at 60 and 70 ºC respectively Arnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404 water solubility 50 mg/ml Human IgG purified. Product Information isoelectric point 6.1-8.5 Agrisera Information about IgG antibodies.
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- InhibitorAntibody
- General Function
- Signal transducer activity
- Specific Function
- Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. ...
- Gene Name
- PDCD1
- Uniprot ID
- Q15116
- Uniprot Name
- Programmed cell death protein 1
- Molecular Weight
- 31646.635 Da
References
- Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [Article]
- Kyriakidis I, Vasileiou E, Rossig C, Roilides E, Groll AH, Tragiannidis A: Invasive Fungal Diseases in Children with Hematological Malignancies Treated with Therapies That Target Cell Surface Antigens: Monoclonal Antibodies, Immune Checkpoint Inhibitors and CAR T-Cell Therapies. J Fungi (Basel). 2021 Mar 5;7(3). pii: jof7030186. doi: 10.3390/jof7030186. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- InhibitorAntibody
- General Function
- Not Available
- Specific Function
- Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell ...
- Gene Name
- CD274
- Uniprot ID
- Q9NZQ7
- Uniprot Name
- Programmed cell death 1 ligand 1
- Molecular Weight
- 33275.095 Da
References
- Kyriakidis I, Vasileiou E, Rossig C, Roilides E, Groll AH, Tragiannidis A: Invasive Fungal Diseases in Children with Hematological Malignancies Treated with Therapies That Target Cell Surface Antigens: Monoclonal Antibodies, Immune Checkpoint Inhibitors and CAR T-Cell Therapies. J Fungi (Basel). 2021 Mar 5;7(3). pii: jof7030186. doi: 10.3390/jof7030186. [Article]
Drug created at February 24, 2015 23:02 / Updated at February 14, 2024 00:55